PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7DL_C343BA649.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 185aa    MW: 20467.9 Da    PI: 10.2444
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7DL_C343BA649.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.85.5e-1480132355
                            XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                            + +r rr+ +NRe+ArrsR+RK a++  Le  v++L++e  +L k+l e +++
  Traes_7DL_C343BA649.2  80 DTRRIRRMVSNRESARRSRRRKHAQLTDLELQVEQLKSESATLFKQLTEANQQ 132
                            56899***************************************777776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-1378142IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.74980132IPR004827Basic-leucine zipper domain
PfamPF001702.5E-1181132IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.68E-1182134No hitNo description
Gene3DG3DSA:1.20.5.1703.2E-1282133No hitNo description
PROSITE patternPS00036085100IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
QNALELQESN AGHVWWSDGL RAPQHHAVPT PTQSQTPAVS ASPRETISGN QALETESDSD  60
SESLVEIGGG RCKRSGKSSD TRRIRRMVSN RESARRSRRR KHAQLTDLEL QVEQLKSESA  120
TLFKQLTEAN QQFTTAVTDN RILKSDVETL RIKVKMAEDM VARGAVSCGL GQQLGLAPFL  180
NSRKM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3613380.0AK361338.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1138D02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010240308.19e-78PREDICTED: basic leucine zipper 9 isoform X1
TrEMBLW5I3151e-134W5I315_WHEAT; Uncharacterized protein
STRINGMLOC_58027.41e-118(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20953796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.12e-28basic leucine zipper 9
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]